Total number of results for Schistocerca gregaria are 29
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP00083 |
ELNFTPNWGT
|
10 | Schistocerca gregaria | AKH/HRTH/RPCH | Adipokinetic hormone | 3063256#Isaac RE#Neuropeptide-degrading endopeptidase activity of locust (Schistocerca gregaria) synaptic membranes#Biochem J 1988 Nov 1;255(3):843-7 | |
NP00084 |
ELNFSWGT
|
8 | Schistocerca gregaria | AKH/HRTH/RPCH | Adipokinetic hormone 2 | 1601107#O'Shea M, Rayne RC#Adipokinetic hormones: cell and molecular biology#Experientia 1992 May 15;48(5):430-8 Review | |
NP00210 |
QLNFTPNWGT
|
10 | Schistocerca gregaria | AKH/HRTH/RPCH | Adipokinetic hormone 1 | 2627375#Hekimi S., Burkhart W., Moyer M., Fowler E., O'Shea M.; #Dimer structure of a neuropeptide precursor established: consequences for processing.; #Neuron 2:1363-1368(1989). | |
NP00211 |
FTPNWGT
|
7 | Schistocerca gregaria | AKH/HRTH/RPCH | Adipokinetic hormone I4-10 | 958472#Stone J.V., Mordue W., Batley K.E., Morris H.R.; #Structure of locust adipokinetic hormone, a neurohormone that regulates lipid utilisation during flight.; #Nature 263:207-211(1976). | |
NP00212 |
DAADFGDPYSFLYRLIQAEARKMSGCSN
|
28 | Schistocerca gregaria | AKH/HRTH/RPCH | Adipokinetic hormone precursor-related peptide alpha chain | 2627375#Hekimi S., Burkhart W., Moyer M., Fowler E., O'Shea M.; #Dimer structure of a neuropeptide precursor established: consequences for processing.; #Neuron 2:1363-1368(1989). | |
NP00213 |
QLNFTPNWGTGKRDAADFGDPYSFLYRLIQAEARKMSGCSN
|
41 | Schistocerca gregaria | AKH/HRTH/RPCH | Adipokinetic prohormone type 1 | 2627375#Hekimi S., Burkhart W., Moyer M., Fowler E., O'Shea M.; #Dimer structure of a neuropeptide precursor established: consequences for processing.; #Neuron 2:1363-1368(1989). | |
NP00214 |
QLNFSTGW
|
8 | Schistocerca gregaria | AKH/HRTH/RPCH | Adipokinetic hormone 2 | 1941082#Hekimi S., Fischer-Lougheed J., O'Shea M.; #Regulation of neuropeptide stoichiometry in neurosecretory cells.; #J. Neurosci. 11:3246-3256(1991).$4063072#Siegert K., Morgan P., Mordue W.; #Primary structures of locust adipokinetic hormones II.; #Biol. Chem. Hoppe-Seyler 366:723-727(1985). | |
NP00215 |
YADPNADPMAFLTKLIQIEARKLSGCSN
|
28 | Schistocerca gregaria | AKH/HRTH/RPCH | Adipokinetic hormone precursor-related peptide beta chain | 1941082#Hekimi S., Fischer-Lougheed J., O'Shea M.; #Regulation of neuropeptide stoichiometry in neurosecretory cells.; #J. Neurosci. 11:3246-3256(1991). | |
NP00216 |
QLNFSTGWGRRYADPNADPMAFLTKLIQIEARKLSGCSN
|
39 | Schistocerca gregaria | AKH/HRTH/RPCH | Adipokinetic prohormone type 2 | 1941082#Hekimi S., Fischer-Lougheed J., O'Shea M.; #Regulation of neuropeptide stoichiometry in neurosecretory cells.; #J. Neurosci. 11:3246-3256(1991). | |
NP00260 |
ATGAASLYSFGL
|
12 | Schistocerca gregaria | Allatostatin | Allatostatin 3 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00261 |
AYTYVSEYKRLPVYNFGL
|
18 | Schistocerca gregaria | Allatostatin | Allatostatin-2 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00262 |
ARPYSFGL
|
8 | Schistocerca gregaria | Allatostatin | Allatostatin-6 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00263 |
APAEHRFSFGL
|
11 | Schistocerca gregaria | Allatostatin | Scg-AST-10 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00264 |
GPRTYSFGL
|
9 | Schistocerca gregaria | Allatostatin | Scg-AST-4 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00265 |
GRLYSFGL
|
8 | Schistocerca gregaria | Allatostatin | Scg-AST-5 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00266 |
AGPAPSRLYSFGL
|
13 | Schistocerca gregaria | Allatostatin | Scg-AST-7 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00267 |
EGRMYSFGL
|
9 | Schistocerca gregaria | Allatostatin | Scg-AST-8 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00729 |
SFFDIQCKGVYDKSIFARLDRICEDCYNLFREPQLHSLCRSDCFKSPYFKGCLQALLLIDEEEKFNQMVEIL
|
72 | Schistocerca gregaria | Arthropod CHH/MIH/GIH/VIH hormone | Ion transport peptide | ||
NP01951 |
PDVDHVFLRF
|
10 | Schistocerca gregaria | FMRFamide related peptide | SchistoFLRFamide | 2719702#Robb S., Packman L.C., Evans P.D.; #Isolation, primary structure and bioactivity of schistoflrf-amide, a FMRF-amide-like neuropeptide from the locust, Schistocerca gregaria.; #Biochem. Biophys. Res. Commun. 160:850-856(1989). | |
NP03166 |
PKYMDT
|
6 | Schistocerca gregaria | NA | PKYMDT | 20171220#Veenstra JA#Neurohormones and neuropeptides encoded by the genome of Lottia gigantea, with reference to other mollusks and insects#Gen Comp Endocrinol 2010 May 15;167(1):86-103 | |
NP03918 |
YSQVARPRF
|
9 | Schistocerca gregaria | NPY | Neuropeptide F | 11179815#Schoofs L., Clynen E., Cerstiaens A., Baggerman G., Wei Z., Vercammen T., Nachman R., De Loof A., Tanaka S.; #Newly discovered functions for some myotropic neuropeptides in locusts.; #Peptides 22:219-227(2001).$19456328#Clynen E., Husson S.J., Schoofs L.; #"Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans."; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
NP03919 |
SNRSPSLRLRF
|
11 | Schistocerca gregaria | NPY | Short neuropeptide F | 19456328#Clynen E., Husson S.J., Schoofs L.; #Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans.; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
NP03920 |
SPSLRLRF
|
8 | Schistocerca gregaria | NPY | Short neuropeptide F4-11 | 19456328#Clynen E., Husson S.J., Schoofs L.; #Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans.; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
NP04690 |
AAGLFQFPRV
|
10 | Schistocerca gregaria | Periviscerokinin | Periviscerokinin-1 | 12504101#Clynen E., Huybrechts J., De Loof A., Schoofs L.; #Mass spectrometric analysis of the perisympathetic organs in locusts: identification of novel periviscerokinins.; #Biochem. Biophys. Res. Commun. 300:422-428(2003). | |
NP04691 |
GLLAFPRV
|
8 | Schistocerca gregaria | Periviscerokinin | Periviscerokinin-2 | 12504101#Clynen E., Huybrechts J., De Loof A., Schoofs L.; #Mass spectrometric analysis of the perisympathetic organs in locusts: identification of novel periviscerokinins.; #Biochem. Biophys. Res. Commun. 300:422-428(2003). | |
NP05000 |
GAAPAAQFSPRL
|
12 | Schistocerca gregaria | Pyrokinin | Schistomyotropin-1 | 11121115#Torfs P, Nieto J, Cerstiaens A, Boon D, Baggerman G, Poulos C, Waelkens E, Derua R, Calderón J, De Loof A, Schoofs L#Pyrokinin neuropeptides in a crustacean#Isolation and identification in the white shrimp Penaeus vannamei Eur J Biochem 2001 Jan;268(1):149-54 | |
NP05199 |
DGAETPGAAASLWFGPRV
|
18 | Schistocerca gregaria | Pyrokinin | Pyrokinin | 12504101#Clynen E., Huybrechts J., De Loof A., Schoofs L.; #Mass spectrometric analysis of the perisympathetic organs in locusts: identification of novel periviscerokinins.; #Biochem. Biophys. Res. Commun. 300:422-428(2003). | |
NP05213 |
TSSLFPHPRL
|
10 | Schistocerca gregaria | Pyrokinin | Schistomyotropin-2 | 11121115#Torfs P, Nieto J, Cerstiaens A, Boon D, Baggerman G, Poulos C, Waelkens E, Derua R, Calderón J, De Loof A, Schoofs L#Pyrokinin neuropeptides in a crustacean#Isolation and identification in the white shrimp Penaeus vannamei Eur J Biochem 2001 Jan;268(1):149-54 $12504101#Clynen E., Huybrechts J., De Loof A., Schoofs L.#Mass spectrometric analysis of the perisympathetic organs in locusts: identification of novel periviscerokinins.#Biochem. Biophys. Res. Commun. 300:422-428(2003). | |
NP05776 |
GNTKKAVPGFYGTR
|
14 | Schistocerca gregaria | Tachykinin | Tachykinin-1 | 10581195#Veelaert D., Baggerman G., Derua R., Waelkens E., Meeusen T., Vande Water G., De Loof A., Schoofs L.; #Identification of a new tachykinin from the midgut of the desert locust, Schistocerca gregaria, by ESI-Qq-oa-TOF mass spectrometry.; #Biochem. Biophys. Res. Commun. 266:237-242(1999). |